DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD1

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001136202.1 Gene:KCTD1 / 284252 HGNCID:18249 Length:865 Species:Homo sapiens


Alignment Length:238 Identity:73/238 - (30%)
Similarity:118/238 - (49%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::||||.:...:.:..|| :|.:.:..|| |..||:||||.:|||||:|||...
Human   640 VHIDVGGHMYTSSLATLTKYPESRIGRLF-DGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSK 703

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAM-LECIRSERD------ARPPGCITIGYRGSFQFGKDGLAD 126
            |.:|:.|::...|..||::|:|..| ||..|.::|      :||..|:.:  |.:...|:     
Human   704 LLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVV--RVAPDLGE----- 761

  Fly   127 VKFRKLSRILVCGRVAQCREVF---GDTLNESRDPDHGGTDRYTSRFFLK-HCYIE--QAFDNLH 185
                   ||.:.|..:...|||   ||.:..|.:........:..||.|. :|::.  |..:.|.
Human   762 -------RITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQ 819

  Fly   186 DHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            ..|:.:.||||.           |||:.:     ::|:|..|:
Human   820 QRGFEIVGSCGG-----------GVDSSQ-----FSEYVLRRE 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 40/93 (43%)
BTB 5..91 CDD:295341 36/86 (42%)
KCTD1NP_001136202.1 DUF3504 284..439 CDD:288835
BTB 640..735 CDD:197585 40/95 (42%)
BTB 640..732 CDD:295341 39/92 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.