DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCNRG

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_775876.1 Gene:KCNRG / 283518 HGNCID:18893 Length:272 Species:Homo sapiens


Alignment Length:95 Identity:40/95 - (42%)
Similarity:60/95 - (63%) Gaps:1/95 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            |::.|||||..:||..:|:.|..::.||.:. :|||...|...|:.|:||||.||.:||||||..
Human     5 ELVTLNVGGKIFTTRFSTIKQFPASRLARML-DGRDQEFKMVGGQIFVDRDGDLFSFILDFLRTH 68

  Fly    68 ALHLPEGFRERQRLLREAEHFKLTAMLECI 97
            .|.||..|.:..||.|||..::|.::::.:
Human    69 QLLLPTEFSDYLRLQREALFYELRSLVDLL 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 39/91 (43%)
BTB 5..91 CDD:295341 38/85 (45%)
KCNRGNP_775876.1 BTB 7..94 CDD:321966 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.