DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD21

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_047282759.1 Gene:KCTD21 / 283219 HGNCID:27452 Length:296 Species:Homo sapiens


Alignment Length:100 Identity:44/100 - (44%)
Similarity:65/100 - (65%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |.:.|.|||||..|||:||||.....::|..:| .|:....:||:|..|:||||.:|||||:|||
Human    37 MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMF-SGKMPTKRDSQGNCFIDRDGKVFRYILNFLR 100

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLECIRSE 100
            ...|.|||.|:|...|.|||:.:::..::|.::.:
Human   101 TSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 44/97 (45%)
H1_KCTD12-like 106..227 CDD:409026
KCTD21XP_047282759.1 BTB_POZ_KCTD21 39..136 CDD:349703 43/97 (44%)
KCTD11_21_C 143..296 CDD:466043
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.