DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD21

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_006718579.1 Gene:KCTD21 / 283219 HGNCID:27452 Length:296 Species:Homo sapiens


Alignment Length:100 Identity:44/100 - (44%)
Similarity:65/100 - (65%) Gaps:1/100 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |.:.|.|||||..|||:||||.....::|..:| .|:....:||:|..|:||||.:|||||:|||
Human    37 MSDPITLNVGGKLYTTSLATLTSFPDSMLGAMF-SGKMPTKRDSQGNCFIDRDGKVFRYILNFLR 100

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLECIRSE 100
            ...|.|||.|:|...|.|||:.:::..::|.::.:
Human   101 TSHLDLPEDFQEMGLLRREADFYQVQPLIEALQEK 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 43/91 (47%)
BTB 5..91 CDD:295341 42/85 (49%)
KCTD21XP_006718579.1 BTB 41..135 CDD:197585 43/94 (46%)
BTB 41..129 CDD:295341 42/88 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.