DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd19

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_011246701.1 Gene:Kctd19 / 279499 MGIID:3045294 Length:962 Species:Mus musculus


Alignment Length:103 Identity:31/103 - (30%)
Similarity:49/103 - (47%) Gaps:21/103 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYF--------LDRDGVLFRY 59
            :||:|.||...|.|||.||::             ...|..:::..|:        :..||.:||:
Mouse   432 QIIKLYVGSHWYATTLQTLMK-------------YPELLSNTQRVYWIAYGQTLLIHGDGQMFRH 483

  Fly    60 ILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECI 97
            ||:|||...|.||..|:|.....:|.|.:.:.|:.|.:
Mouse   484 ILNFLRLGKLFLPSEFKEWPLFCQEVEEYHIPALSEAL 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 30/99 (30%)
BTB 5..91 CDD:295341 28/93 (30%)
Kctd19XP_011246701.1 BTB1_POZ_KCTD19 27..124 CDD:349682
BTB_POZ <196..268 CDD:365784
BTB_POZ 321..389 CDD:365784
BTB2_POZ_KCTD19 432..530 CDD:349683 31/103 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.