DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and F59F3.6

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_741899.1 Gene:F59F3.6 / 259724 WormBaseID:WBGene00010335 Length:173 Species:Caenorhabditis elegans


Alignment Length:100 Identity:37/100 - (37%)
Similarity:51/100 - (51%) Gaps:7/100 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGR-DSLAKDSKGRYFLDRDGVLFRYILDFLRD 66
            :|:.:||||..||.....:|.|..:.|||.|..|. ..:|.|..|.|:||||...||:||.:||.
 Worm     9 DILNINVGGKKYTVRRTDMLADPRSKLAEWFKPGTLKPIATDKGGNYYLDRDAKCFRHILAYLRL 73

  Fly    67 K------ALHLPEGFRERQRLLREAEHFKLTAMLE 95
            |      :|.||....:..:|:.|.|...|..:.|
 Worm    74 KKEKFVPSLALPSKPDDLAKLVGECEALNLAELKE 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 35/97 (36%)
BTB 5..91 CDD:295341 34/92 (37%)
F59F3.6NP_741899.1 BTB_POZ_KCTD-like 11..99 CDD:349625 33/87 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5359
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.