DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd14

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_006507670.2 Gene:Kctd14 / 233529 MGIID:1289222 Length:311 Species:Mus musculus


Alignment Length:146 Identity:39/146 - (26%)
Similarity:76/146 - (52%) Gaps:19/146 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKA 68
            ::||||||..||||:.||::...:..:|:........ ||::||:|:||.|..|..:||:||...
Mouse    96 VVELNVGGQFYTTTMGTLMKHPGSKFSEILSRSARHY-KDAQGRFFIDRPGTYFGLLLDYLRTGQ 159

  Fly    69 L---HLPEGFRERQRLLREAEHFKLTAMLECIR------SERDARPPGCITI-GYRGSFQFGKD- 122
            :   ::||       :.:||:.:::..:::.:.      .|:.||....:.: .||.:.:.... 
Mouse   160 VPTEYVPE-------VYQEAKFYQIHLLVKILEDMPQIFGEQVARTQFLMGVPNYRENLEVLLHL 217

  Fly   123 GLADVKFRKLSRILVC 138
            ..|:....:.|:::||
Mouse   218 ARAEAVAMRSSKVVVC 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 30/94 (32%)
BTB 5..91 CDD:295341 30/88 (34%)
Kctd14XP_006507670.2 BTB_POZ 96..192 CDD:365784 30/103 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.