DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd15

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_666300.1 Gene:Kctd15 / 233107 MGIID:2385276 Length:283 Species:Mus musculus


Alignment Length:242 Identity:75/242 - (30%)
Similarity:114/242 - (47%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::||||.:...:.::.|| .|.:.:..|| |..||:||||.:|||||.|||...
Mouse    58 VHIDVGGHMYTSSLATLTKYPDSRISRLF-NGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTSK 121

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAML-ECIRSERD----ARPPGCITIGYRGSFQFGKDGLADVK 128
            |.||:.|::...|..||.:::|..|: |..|.::|    .|...|..:..|.:...|:       
Mouse   122 LLLPDDFKDFNLLYEEARYYQLQPMVRELERWQQDQEQRRRSRACDCLVVRVTPDLGE------- 179

  Fly   129 FRKLSRILVCGRVAQCREVF---GDTLNES------RDPDHGGTDRYTSRFFLK-HCYIE--QAF 181
                 ||.:.|..|...|||   ||.:..|      :||.|      ..||.|. :|.:.  |..
Mouse   180 -----RIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTH------VIRFPLNGYCRLNSVQVL 233

  Fly   182 DNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            :.|...|:.:|.|||.           |||:.:     ::|:|..|:
Mouse   234 ERLFQRGFSVAASCGG-----------GVDSSQ-----FSEYVLCRE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 39/95 (41%)
H1_KCTD12-like 106..227 CDD:409026 32/132 (24%)
Kctd15NP_666300.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCTD15 55..153 CDD:349696 39/95 (41%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.