DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd15

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001347747.1 Gene:Kctd15 / 233107 MGIID:2385276 Length:283 Species:Mus musculus


Alignment Length:242 Identity:75/242 - (30%)
Similarity:114/242 - (47%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::||||.:...:.::.|| .|.:.:..|| |..||:||||.:|||||.|||...
Mouse    58 VHIDVGGHMYTSSLATLTKYPDSRISRLF-NGTEPIVLDSLKQHYFIDRDGEIFRYILSFLRTSK 121

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAML-ECIRSERD----ARPPGCITIGYRGSFQFGKDGLADVK 128
            |.||:.|::...|..||.:::|..|: |..|.::|    .|...|..:..|.:...|:       
Mouse   122 LLLPDDFKDFNLLYEEARYYQLQPMVRELERWQQDQEQRRRSRACDCLVVRVTPDLGE------- 179

  Fly   129 FRKLSRILVCGRVAQCREVF---GDTLNES------RDPDHGGTDRYTSRFFLK-HCYIE--QAF 181
                 ||.:.|..|...|||   ||.:..|      :||.|      ..||.|. :|.:.  |..
Mouse   180 -----RIALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTH------VIRFPLNGYCRLNSVQVL 233

  Fly   182 DNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            :.|...|:.:|.|||.           |||:.:     ::|:|..|:
Mouse   234 ERLFQRGFSVAASCGG-----------GVDSSQ-----FSEYVLCRE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 39/93 (42%)
BTB 5..91 CDD:295341 36/86 (42%)
Kctd15NP_001347747.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..33
BTB_POZ_KCTD15 55..153 CDD:349696 39/95 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.