DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and Kctd12b

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_780638.1 Gene:Kctd12b / 207474 MGIID:2444667 Length:292 Species:Mus musculus


Alignment Length:279 Identity:111/279 - (39%)
Similarity:152/279 - (54%) Gaps:58/279 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELFG-EGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            ||||||||||..|.|...||:....:.|.|:|. :...||.:|:|||:|:||||.||||:||::|
Mouse    20 PEIIELNVGGQVYITRYPTLISIPGSRLWEMFSVKNPCSLIQDNKGRFFIDRDGFLFRYVLDYMR 84

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLECIRSE--------RDARP----------------- 105
            |..:.||:.|.|..||.||||:|||..:.:.:..:        .|:.|                 
Mouse    85 DMQVVLPDHFPECGRLHREAEYFKLPELAKMLAPKMNKLNSIGNDSCPIDLEELSPSIDTTFNFS 149

  Fly   106 --------------------------PGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQC 144
                                      .|.||||||||:..|:|..||.|||:::||:|||:::..
Mouse   150 STNSIHISGPDNPMVLRAAPGSELKKAGFITIGYRGSYTLGRDSQADAKFRRVARIMVCGKISLA 214

  Fly   145 REVFGDTLNESRDPDHGGTDRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAAEPKPG 209
            :||||||||||||||. ..:|||||::||..::|||||.|.|.|:.|.....:||.....:    
Mouse   215 KEVFGDTLNESRDPDR-PPERYTSRYYLKFTFLEQAFDKLADAGFHMVACNSTGTCTVTHD---- 274

  Fly   210 VDTEENRWNHYNEFVFIRD 228
             .|::..|..|.|:||.|:
Mouse   275 -QTDDRIWTSYTEYVFYRE 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 46/92 (50%)
BTB 5..91 CDD:295341 45/86 (52%)
Kctd12bNP_780638.1 BTB_POZ_KCTD8-like 19..118 CDD:349676 49/97 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 125 1.000 Domainoid score I5438
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 223 1.000 Inparanoid score I3509
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49144
OrthoDB 1 1.010 - - D1579292at2759
OrthoFinder 1 1.000 - - FOG0001212
OrthoInspector 1 1.000 - - otm43437
orthoMCL 1 0.900 - - OOG6_106901
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2965
SonicParanoid 1 1.000 - - X239
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.870

Return to query results.
Submit another query.