DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and ZC239.16

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494482.1 Gene:ZC239.16 / 191126 WormBaseID:WBGene00022574 Length:155 Species:Caenorhabditis elegans


Alignment Length:97 Identity:34/97 - (35%)
Similarity:51/97 - (52%) Gaps:8/97 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEIIELNVGGVSYTTTLATLLQDKS---TLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILD 62
            |.|||:|:|||..:.|:..||.:..|   |:|     |.:.....:..|..|:||....|..||:
 Worm     1 MSEIIKLDVGGTIFKTSKDTLTKFHSFFKTML-----ECKTGPKIEKTGCIFIDRSPKHFELILN 60

  Fly    63 FLRDKALHLPEGFRERQRLLREAEHFKLTAML 94
            .:||..|.|||..||.:.|:.||:.:.|..::
 Worm    61 LMRDGDLPLPEDERELRELMAEAQFYWLDGLV 92

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 34/97 (35%)
H1_KCTD12-like 106..227 CDD:409026
ZC239.16NP_494482.1 BTB_2 5..96 CDD:426665 31/93 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.