DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and sdz-35

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494473.2 Gene:sdz-35 / 191123 WormBaseID:WBGene00022570 Length:225 Species:Caenorhabditis elegans


Alignment Length:104 Identity:37/104 - (35%)
Similarity:54/104 - (51%) Gaps:13/104 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDK---STLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFL 64
            |.|.||:||..:.|:.:||.:..   .|||     |....:.||.....|:||....|..||::|
 Worm     6 EKIRLNIGGTIFETSKSTLTKFDGFFKTLL-----ETEIPIQKDDSNCIFIDRSPRHFEKILNYL 65

  Fly    65 RDKA---LHLPEGFRERQRLLREAEHFKLTAMLE-CIRS 99
            ||.|   | |||..:|.:.:|:||:.:....::| |.||
 Worm    66 RDGADVDL-LPESEKEVREILKEAQFYLKEGLMELCKRS 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 35/102 (34%)
H1_KCTD12-like 106..227 CDD:409026
sdz-35NP_494473.2 BTB_2 8..100 CDD:426665 33/97 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.