DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and ZC239.5

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001379686.1 Gene:ZC239.5 / 191122 WormBaseID:WBGene00022568 Length:204 Species:Caenorhabditis elegans


Alignment Length:92 Identity:33/92 - (35%)
Similarity:50/92 - (54%) Gaps:5/92 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKA 68
            ||:|||||..::||.|||     |.....|.:...:..|..:...|:||....|..||:|:||..
 Worm     5 IIKLNVGGKEFSTTEATL-----TKFEGYFKQKLKTRGKIWQTTLFIDRSPTHFEIILNFMRDGK 64

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAMLE 95
            :.|||..:|...:.||.|::.|.:::|
 Worm    65 VDLPETLKELMPIFRETEYYTLASLVE 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 33/92 (36%)
H1_KCTD12-like 106..227 CDD:409026
ZC239.5NP_001379686.1 BTB_2 6..93 CDD:426665 32/91 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.