DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and ZC239.3

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001370450.1 Gene:ZC239.3 / 191120 WormBaseID:WBGene00022566 Length:248 Species:Caenorhabditis elegans


Alignment Length:98 Identity:30/98 - (30%)
Similarity:49/98 - (50%) Gaps:5/98 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            ::|.||:||..:.|..:||::........|...| .||...    .|:||....|..:|:|:|..
 Worm     7 KVIRLNIGGKRFDTHKSTLMKFDGYFKKFLQTPG-SSLVDP----IFVDRSPTYFDIVLNFMRKG 66

  Fly    68 ALHLPEGFRERQRLLREAEHFKLTAMLECIRSE 100
            ...|||...:.:.||.|||:::||.:.:..:.|
 Worm    67 RADLPETLIDLKMLLDEAEYYELTELCDDCKRE 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 29/95 (31%)
H1_KCTD12-like 106..227 CDD:409026
ZC239.3NP_001370450.1 BTB_2 9..96 CDD:426665 29/91 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.