DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and K02F6.5

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001364769.1 Gene:K02F6.5 / 186908 WormBaseID:WBGene00019339 Length:232 Species:Caenorhabditis elegans


Alignment Length:107 Identity:30/107 - (28%)
Similarity:52/107 - (48%) Gaps:28/107 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATL------------LQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVL 56
            :|.|:|||..::|..:||            |:|:|:                :..|..:||....
 Worm     1 MIRLDVGGRKFSTNRSTLTKFDGYFRKLPKLKDESS----------------TTTRIVIDRSPKH 49

  Fly    57 FRYILDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECIR 98
            |..:|:|:||.::.|||..:..::|||||..:.|..::||.:
 Worm    50 FETVLNFMRDGSVDLPESLKHLRQLLREAIFYGLEKLIECCK 91

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 30/107 (28%)
H1_KCTD12-like 106..227 CDD:409026
K02F6.5NP_001364769.1 BTB_2 2..90 CDD:426665 29/103 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.