DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and F47D12.3

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_498381.1 Gene:F47D12.3 / 185932 WormBaseID:WBGene00018560 Length:140 Species:Caenorhabditis elegans


Alignment Length:109 Identity:33/109 - (30%)
Similarity:50/109 - (45%) Gaps:13/109 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDK------------STLLAELFGEGRDSLAKDSKGRYFLDRDGVLF 57
            :.|.|||..|...:.||:...            |....::.|...|:.....|.|..:|||||||
 Worm    14 LNLFVGGEMYPVQVKTLMNPTTCGSYFRDVVKVSDAAIKVRGVQWDTAPNHIKFRVDIDRDGVLF 78

  Fly    58 RYILDFLRD-KALHLPEGFRERQRLLREAEHFKLTAMLECIRSE 100
            |::|.:||: |...||:.....:.|:.|||.|.|....|.::.:
 Worm    79 RHVLQYLRNGKLTSLPDDIFTLESLVAEAEFFGLEKYREMLKKK 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 33/104 (32%)
BTB 5..91 CDD:295341 31/98 (32%)
F47D12.3NP_498381.1 BTB <71..114 CDD:295341 20/42 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.