DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and C40A11.7

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494199.1 Gene:C40A11.7 / 183355 WormBaseID:WBGene00016550 Length:220 Species:Caenorhabditis elegans


Alignment Length:110 Identity:34/110 - (30%)
Similarity:56/110 - (50%) Gaps:15/110 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDK---STLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |::|||||..:.|..:||.:..   .||:     |....:.||:...||:||....|..:|:::|
 Worm     7 IVKLNVGGSVFETWKSTLTKQDGFFKTLV-----ETNIPVKKDTSDCYFIDRSPKYFETVLNYMR 66

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLE-C------IRSERDA 103
            .....||:..:|.|.|.:|||.:.|..::: |      ||:.|.:
 Worm    67 SGVTVLPDSEKELQELKKEAEFYLLEQLVDLCEPINNQIRTYRSS 111

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 32/104 (31%)
H1_KCTD12-like 106..227 CDD:409026
C40A11.7NP_494199.1 BTB_2 8..98 CDD:426665 29/94 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.