DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and C40A11.3

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494196.2 Gene:C40A11.3 / 183353 WormBaseID:WBGene00016546 Length:231 Species:Caenorhabditis elegans


Alignment Length:91 Identity:31/91 - (34%)
Similarity:47/91 - (51%) Gaps:2/91 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKA 68
            |:.||:||..:.|:.|||.....  ..::..|....|.||.....|:||....|..||:||||..
 Worm     7 IMMLNIGGTVFHTSKATLTGING--FFKMLLESDIPLHKDESNCIFIDRSPKHFDVILNFLRDGD 69

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAML 94
            :.|||..:|.:.:.|||:.:.|..::
 Worm    70 VDLPELEKEVKEVRREAQFYLLDGLV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 31/91 (34%)
H1_KCTD12-like 106..227 CDD:409026
C40A11.3NP_494196.2 BTB_POZ_KCTD-like 8..89 CDD:349625 29/82 (35%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.