DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and C40A11.2

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494198.3 Gene:C40A11.2 / 183352 WormBaseID:WBGene00016545 Length:213 Species:Caenorhabditis elegans


Alignment Length:98 Identity:28/98 - (28%)
Similarity:50/98 - (51%) Gaps:11/98 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQ----DKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDF 63
            |.|:|::||..:.|....|.:    .|:.|.:::      .::.|..|..|:||....|..||.:
 Worm     6 EPIKLDIGGTVFETCKLKLTKFDGFFKTMLTSDI------PVSIDESGCIFVDRSPKNFSLILKY 64

  Fly    64 LRD-KALHLPEGFRERQRLLREAEHFKLTAMLE 95
            |:: ..:.||:..||.|.:.||||.:.|..:::
 Worm    65 LKEGDDVELPKFERELQEVRREAEFYLLDGLVD 97

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 28/98 (29%)
H1_KCTD12-like 106..227 CDD:409026
C40A11.2NP_494198.3 BTB_POZ 8..107 CDD:453885 27/96 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.