DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and ZC239.13

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001254063.1 Gene:ZC239.13 / 173664 WormBaseID:WBGene00022571 Length:84 Species:Caenorhabditis elegans


Alignment Length:82 Identity:31/82 - (37%)
Similarity:43/82 - (52%) Gaps:3/82 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |.|.::|:|||..:.|:..||::..|.....|  |....|..|..|..|:||....|..||:|:|
 Worm     1 MSETVKLDVGGTIFKTSKDTLMKLDSIFKTML--ESGTGLELDESGCIFIDRSPKHFNRILNFMR 63

  Fly    66 DKALHLPEGFRE-RQRL 81
            |..|.|||.::. .|||
 Worm    64 DGDLSLPENWKNCWQRL 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 31/82 (38%)
H1_KCTD12-like 106..227 CDD:409026
ZC239.13NP_001254063.1 BTB_POZ_KCTD-like 5..72 CDD:349625 25/68 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.