DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and ZC239.6

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_494474.2 Gene:ZC239.6 / 173663 WormBaseID:WBGene00022569 Length:258 Species:Caenorhabditis elegans


Alignment Length:94 Identity:29/94 - (30%)
Similarity:46/94 - (48%) Gaps:8/94 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDKA 68
            ::.|||||..:.|:.|||     |.....|....:....:.....|:||....|..||:|:||..
 Worm     1 MLRLNVGGKEFVTSKATL-----TKFDGYFKNLPEIQQVNPTSPIFVDRSPKHFETILNFMRDGD 60

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAML-EC 96
            :.||:.:  ..:|||||..:.|..:: :|
 Worm    61 VDLPQEY--LNQLLREARFYGLVKLVRDC 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 29/94 (31%)
H1_KCTD12-like 106..227 CDD:409026
ZC239.6NP_494474.2 BTB_2 2..87 CDD:426665 28/91 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.