DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and F22E5.8

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001364741.1 Gene:F22E5.8 / 173610 WormBaseID:WBGene00017707 Length:232 Species:Caenorhabditis elegans


Alignment Length:95 Identity:31/95 - (32%)
Similarity:49/95 - (51%) Gaps:2/95 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |.|.::|:|||..:.|:.:||.:....|  ::..|....|..|..|..|:||....|..||:|:|
 Worm     1 MSETVQLDVGGTIFKTSKSTLTKFNGFL--KIMLESDIGLKIDESGSIFIDRSPKHFDLILNFMR 63

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLE 95
            |..:.||......:.||.||:.:.|..::|
 Worm    64 DGDVVLPSCELTVKELLAEAQFYLLDELIE 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 31/95 (33%)
H1_KCTD12-like 106..227 CDD:409026
F22E5.8NP_001364741.1 BTB_2 5..95 CDD:426665 29/91 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.