DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD7

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_694578.1 Gene:KCTD7 / 154881 HGNCID:21957 Length:289 Species:Homo sapiens


Alignment Length:260 Identity:68/260 - (26%)
Similarity:110/260 - (42%) Gaps:75/260 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRD 66
            ||::.||:||..:||.|:||...:.|:||.:| .||..:..||:||||:||||..|..:|:|||.
Human    50 PEVVPLNIGGAHFTTRLSTLRCYEDTMLAAMF-SGRHYIPTDSEGRYFIDRDGTHFGDVLNFLRS 113

  Fly    67 KALHLPEGFRERQR-LLREAEHFKLTAMLECIRSERDARPPGCITIGYRGSFQFGKDGLADV--- 127
            .  .||.  |||.| :.:||:::.:..:||.:.:.:..:... :...:.|...:.||.|..:   
Human   114 G--DLPP--RERVRAVYKEAQYYAIGPLLEQLENMQPLKGEK-VRQAFLGLMPYYKDHLERIVEI 173

  Fly   128 -KFRKLSRILVCGRVAQCREVFGD-------------TLNESRDPDHGGTDRYTSRFFLKHCYIE 178
             :.|.:.|.....::..|  ||.:             :|...|....|       :.|..||.::
Human   174 ARLRAVQRKARFAKLKVC--VFKEEMPITPYECPLLNSLRFERSESDG-------QLFEHHCEVD 229

  Fly   179 QAF----------DNLH-------------DHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHY 220
            .:|          |.||             ||  :..|.|                 :::..|||
Human   230 VSFGPWEAVADVYDLLHCLVTDLSAQGLTVDH--QCIGVC-----------------DKHLVNHY 275

  Fly   221  220
            Human   276  275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 40/92 (43%)
BTB 5..91 CDD:295341 38/86 (44%)
KCTD7NP_694578.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..35
BTB_POZ_KCTD7 48..139 CDD:349675 40/93 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.