DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD19

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001094385.1 Gene:KCTD19 / 146212 HGNCID:24753 Length:926 Species:Homo sapiens


Alignment Length:102 Identity:31/102 - (30%)
Similarity:49/102 - (48%) Gaps:19/102 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAE-------LFGEGRDSLAKDSKGRYFLDRDGVLFRYI 60
            :||::.||...|.|||.|||: ...||:.       .:|:           ...:..||.:||:|
Human   396 QIIKVYVGSHWYATTLQTLLK-YPELLSNPQRVYWITYGQ-----------TLLIHGDGQMFRHI 448

  Fly    61 LDFLRDKALHLPEGFRERQRLLREAEHFKLTAMLECI 97
            |:|||...|.||..|:|.....:|.|.:.:.::.|.:
Human   449 LNFLRLGKLFLPSEFKEWPLFCQEVEEYHIPSLSEAL 485

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 30/98 (31%)
BTB 5..91 CDD:295341 29/92 (32%)
KCTD19NP_001094385.1 BTB 18..>72 CDD:321966
BTB 398..488 CDD:321966 30/100 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 673..751
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR14499
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.