DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD18

DIOPT Version :10

Sequence 1:NP_650926.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_689600.2 Gene:KCTD18 / 130535 HGNCID:26446 Length:426 Species:Homo sapiens


Alignment Length:86 Identity:33/86 - (38%)
Similarity:51/86 - (59%) Gaps:2/86 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDSKGRYFLDRDGVLFRYILDFLRDK 67
            :::.|||||..||....:|.:.|.::||.:| .||..|..|..|...:||||.||:|:||:|..:
Human    12 DVLRLNVGGCIYTARRESLCRFKDSMLASMF-SGRFPLKTDESGACVIDRDGRLFKYLLDYLHGE 75

  Fly    68 ALHLPEGFRERQRLLREAEHF 88
             :.:|...:.|..|..||::|
Human    76 -VQIPTDEQTRIALQEEADYF 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_650926.1 BTB_POZ_KCTD8-like 1..99 CDD:349676 33/86 (38%)
H1_KCTD12-like 106..227 CDD:409026
KCTD18NP_689600.2 BTB_POZ_KCTD18 12..112 CDD:349681 33/86 (38%)
KCTD18_C 114..426 CDD:466040
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 305..371
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..408
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.