DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and KCTD12

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_612453.1 Gene:KCTD12 / 115207 HGNCID:14678 Length:325 Species:Homo sapiens


Alignment Length:297 Identity:114/297 - (38%)
Similarity:154/297 - (51%) Gaps:74/297 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGR-DSLAKDSKGRYFLDRDGVLFRYILDFLR 65
            |:|:||||||..|.|...|::....:||..:|.:.: ..||:|||||:||||||.|||||||:||
Human    33 PDIVELNVGGQVYVTRRCTVVSVPDSLLWRMFTQQQPQELARDSKGRFFLDRDGFLFRYILDYLR 97

  Fly    66 DKALHLPEGFRERQRLLREAEHFKLTAMLECIRS------------------------------- 99
            |..|.||:.|.||.||.||||:|:|..::..:.:                               
Human    98 DLQLVLPDYFPERSRLQREAEYFELPELVRRLGAPQQPGPGPPPSRRGVHKEGSLGDELLPLGYS 162

  Fly   100 -----------------ERDARPP---------------------GCITIGYRGSFQFGKDGLAD 126
                             |..:|.|                     |.||||||||:..|:|..||
Human   163 EPEQQEGASAGAPSPTLELASRSPSGGAAGPLLTPSQSLDGSRRSGYITIGYRGSYTIGRDAQAD 227

  Fly   127 VKFRKLSRILVCGRVAQCREVFGDTLNESRDPDHGGTDRYTSRFFLKHCYIEQAFDNLHDHGYRM 191
            .|||:::||.|||:.:..:||||||||||||||. ..:|||||::||..::|||||.|.:.|:.|
Human   228 AKFRRVARITVCGKTSLAKEVFGDTLNESRDPDR-PPERYTSRYYLKFNFLEQAFDKLSESGFHM 291

  Fly   192 AGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            .....:||...|:...   .:|:..|..|.|:||.|:
Human   292 VACSSTGTCAFASSTD---QSEDKIWTSYTEYVFCRE 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 49/92 (53%)
BTB 5..91 CDD:295341 48/86 (56%)
KCTD12NP_612453.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
BTB 36..125 CDD:321966 49/88 (56%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..202 3/72 (4%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158085
Domainoid 1 1.000 125 1.000 Domainoid score I5490
eggNOG 1 0.900 - - E1_KOG2723
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 224 1.000 Inparanoid score I3521
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49144
OrthoDB 1 1.010 - - D1579292at2759
OrthoFinder 1 1.000 - - FOG0001212
OrthoInspector 1 1.000 - - otm41381
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR14499
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2965
SonicParanoid 1 1.000 - - X239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.900

Return to query results.
Submit another query.