DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and kctd1

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_012820753.2 Gene:kctd1 / 100486970 XenbaseID:XB-GENE-6076050 Length:840 Species:Xenopus tropicalis


Alignment Length:238 Identity:72/238 - (30%)
Similarity:117/238 - (49%) Gaps:45/238 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDSLAKDS-KGRYFLDRDGVLFRYILDFLRDKA 68
            :.::|||..||::||||.:...:.:..|| :|.:.:..|| |..||:||||.:|||||:|||...
 Frog   615 VHIDVGGHMYTSSLATLTKYPDSRIGRLF-DGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSK 678

  Fly    69 LHLPEGFRERQRLLREAEHFKLTAM-LECIRSERD------ARPPGCITIGYRGSFQFGKDGLAD 126
            |.:.:.|::...|..||::|:|..| ||..|.::|      :||..|:.:  |.:...|:     
 Frog   679 LLISDDFKDYSLLYEEAKYFQLQPMLLELERWKQDKEAGRFSRPCECLVV--RVAPDLGE----- 736

  Fly   127 VKFRKLSRILVCGRVAQCREVF---GDTLNESRDPDHGGTDRYTSRFFLK-HCYIE--QAFDNLH 185
                   ||.:.|..:...|||   ||.:..|.:........:..||.|. :|::.  |..:.|.
 Frog   737 -------RITLSGDKSLIEEVFPEIGDVMCNSVNAGWNHDSTHVIRFPLNGYCHLNSVQVLERLQ 794

  Fly   186 DHGYRMAGSCGSGTAGSAAEPKPGVDTEENRWNHYNEFVFIRD 228
            ..|:.:.||||.           |||:.:     ::|:|..|:
 Frog   795 HRGFEIVGSCGG-----------GVDSSQ-----FSEYVLRRE 821

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 39/93 (42%)
BTB 5..91 CDD:295341 35/86 (41%)
kctd1XP_012820753.2 DNA_BRE_C 270..435 CDD:412227
BTB_POZ_KCTD1 611..715 CDD:349695 41/100 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.