DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ktl and XB5843935

DIOPT Version :9

Sequence 1:NP_001303467.1 Gene:Ktl / 42475 FlyBaseID:FBgn0038839 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001096229.1 Gene:XB5843935 / 100124783 XenbaseID:XB-GENE-5843936 Length:287 Species:Xenopus tropicalis


Alignment Length:275 Identity:118/275 - (42%)
Similarity:158/275 - (57%) Gaps:55/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PEIIELNVGGVSYTTTLATLLQDKSTLLAELFGEGRDS--LAKDSKGRYFLDRDGVLFRYILDFL 64
            |:||||||||..|.|...||:....:||:|:|.: |:|  ||:||||||||||||.||||:||::
 Frog    20 PDIIELNVGGQVYITRYPTLVSVPGSLLSEMFSQ-RNSRPLARDSKGRYFLDRDGFLFRYVLDYM 83

  Fly    65 RDKALHLPEGFRERQRLLREAEHFKLTAMLECIR-----------------SER----------- 101
            ||:.|.||:.|.||.||.||||.|:|..:::.:.                 ||.           
 Frog    84 RDQQLVLPDHFPERLRLQREAEFFRLPELVKILAPKVSKQNSIGDDAFQSDSEEQSPNVEVARNL 148

  Fly   102 ------------------DARPPGCITIGYRGSFQFGKDGLADVKFRKLSRILVCGRVAQCREVF 148
                              |.|..|.||||||||:..|:|...|.|||:::||:|||:.:..:|||
 Frog   149 ASVSAALAAAAGNQSTMSDLRRSGFITIGYRGSYTLGRDSQTDAKFRRVARIMVCGKTSLAKEVF 213

  Fly   149 GDTLNESRDPDHGGTDRYTSRFFLKHCYIEQAFDNLHDHGYRMAGSCGSGTAGSAAEPKPGVDTE 213
            |||||:|||||. ..:|||||::||..::|||||.|.|.|:.|.....:||...|.:     .|:
 Frog   214 GDTLNDSRDPDR-PPERYTSRYYLKFTFLEQAFDRLADAGFHMVACNSTGTCAFAHD-----QTD 272

  Fly   214 ENRWNHYNEFVFIRD 228
            :..|..|.|:||.|:
 Frog   273 DKIWTSYTEYVFYRE 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KtlNP_001303467.1 BTB 5..97 CDD:197585 53/93 (57%)
BTB 5..91 CDD:295341 52/87 (60%)
XB5843935NP_001096229.1 BTB_POZ_KCTD8-like 19..118 CDD:349676 55/98 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 98 1.000 Domainoid score I7043
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I3393
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001212
OrthoInspector 1 1.000 - - otm48582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2965
SonicParanoid 1 1.000 - - X239
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.080

Return to query results.
Submit another query.