DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment KaiR1D and Ir7f

DIOPT Version :9

Sequence 1:NP_650925.1 Gene:KaiR1D / 42473 FlyBaseID:FBgn0038837 Length:853 Species:Drosophila melanogaster
Sequence 2:NP_001138177.1 Gene:Ir7f / 7354418 FlyBaseID:FBgn0259188 Length:621 Species:Drosophila melanogaster


Alignment Length:445 Identity:80/445 - (17%)
Similarity:160/445 - (35%) Gaps:112/445 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   437 PLSGNDQFEGYAVDLIHEISKSLGFNYK---IQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLA 498
            |.....:..|:.:.|:..:::.:.|:.:   |.|:...:|   ....|...|.|.:||::..:::
  Fly   246 PKHNRSRGSGFEIQLVEHLARRMNFSLELVNIALLRPNAY---RLAEGSSEGPIEKLLQRNVNIS 307

  Fly   499 IADLTITFEREQAVDFTTPF----MNLGVSIL----YRKPIKQPPNLFSFLSPLSLDVWIYMATA 555
            :.....|..|.|.:  |||.    .|| |::|    ||     ..:|...:.|..|.||:.:..|
  Fly   308 MGYFRKTARRNQLL--TTPMSYYSANL-VAVLQLERYR-----IGSLALLVFPFELSVWMLLLLA 364

  Fly   556 ---YLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTR 617
               :||:.:                ..|.....|.....|..:...:|:.:.:    ||::...|
  Fly   365 LLIHLGIHL----------------PSARRGNEEDGGGGLQVVALLLGAALAR----LPRSWRHR 409

  Fly   618 MVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKI 682
            .:|..|.:.::.:..||.:.|...:.::..::|..|.:.|..:      ..:|..||        
  Fly   410 FIAAHWLWASIPLRISYQSLLFHLIRLQLYNTPSFSLDQLLAE------GFQGICTA-------- 460

  Fly   683 STYQRMWSFMESARP----------------SVFTASNGEGVERVAKGKGSYAFLMES------- 724
            :|.:.:....:.||.                :|.|.:....:..||....:.:||..|       
  Fly   461 NTQRLLLEMPQLARDPDSIQSVDTPFDWDVLNVLTRNRNRKIFAVANQDVTLSFLHSSAHPNAFH 525

  Fly   725 -----TSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWW 784
                 .::||.                   |:..|.:|.....::..|.:|...|.:|.     |
  Fly   526 VVKQPVNVEYA-------------------GMYMPKHSFLYEKMDDDIRRLDASGFIHA-----W 566

  Fly   785 KEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVWKSR 839
            :........|.|....:| ...:..|.:.|:::|:.|...:|.::...|.:.:.|
  Fly   567 RRASFASVHRKEQVHMTS-RRYINHAKLSGIYMVMAGLYLLAGLLFAGEVLLRQR 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
KaiR1DNP_650925.1 PBP1_iGluR_Kainate 31..397 CDD:107377
ANF_receptor 42..378 CDD:279440
Periplasmic_Binding_Protein_Type_2 415..785 CDD:304360 69/389 (18%)
Lig_chan 547..823 CDD:278489 50/306 (16%)
Ir7fNP_001138177.1 Periplasmic_Binding_Protein_Type_2 231..>358 CDD:304360 27/122 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1052
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.