DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Ir94d

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_001138099.1 Gene:Ir94d / 7354412 FlyBaseID:FBgn0259193 Length:593 Species:Drosophila melanogaster


Alignment Length:489 Identity:91/489 - (18%)
Similarity:178/489 - (36%) Gaps:97/489 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   412 PVLGFVCQELAFPHI--EHHFRNI---TMDILTVHNPPWQILTKNSNGVIVEHKGIVMEIVKELS 471
            |||.|:.:.|....:  |....|:   .:.|....:.|..|:.::..|.:: ..|.|...:|...
  Fly   155 PVLQFIERRLDNSTVIFEKRLENLHGYEVPIALGGSSPRLIVYRDLEGKLI-FSGPVGNFMKSFE 218

  Fly   472 RALNF----SYYLHEASAWKEEDSLSTSAGGNESDELVGSMTFRIPYRVVEMVQGNQFFIAAVAA 532
            :..|.    .|...|::.....|.:::...|:....| |::..::||.                 
  Fly   219 QRYNCRLVQPYPFDESAISPARDLIASVQNGSVQIAL-GAIYPQVPYT----------------- 265

  Fly   533 TVEDPDQKPFNYTQPISVQKYSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLYAINR 597
                      .|:.||.:..:..:...|:||....|::..|:...:...:..::|.:.||....|
  Fly   266 ----------GYSYPIELMSWCLMMPVPEEVPHSQLYSMVFSPMAFGITIVAMVLISLTLSMALR 320

  Fly   598 LAPLKEMRIVGLSTV---KSCFWYIFGALLQQGGMYLPTADSGRLVVGFWWIVVI--VLVTTYCG 657
            |...:    |..|..   .||   :.|.|.|.   :.....:..|:...:.::.:  :|:|::..
  Fly   321 LHGYR----VSFSEYFLHDSC---LRGVLSQS---FYEVLRAPALIKAMYLVICLLGLLITSWYN 375

  Fly   658 NLVAFLTFPKFQPGVDYLNQLED--HKDI------VQYGLRNGTFFERYVQSTT-----REDFKH 709
            :.  |.||....|....|...|.  |.:|      .:|.:.  .||...::..:     :||:|.
  Fly   376 SY--FSTFVTSAPRFPQLTSYESIRHSNIKIVIWKPEYEML--LFFSENMEKYSSIFQLQEDYKE 436

  Fly   710 YLERAKIYGSAQEEDIEAVKRGERINID-WRINLQLIVQRHFEREKECHFALGRESFVDEQIAMI 773
            :|..         .|....:.|..:.:: |  :|....||.|....   |:|..:..|...:.::
  Fly   437 FLHL---------RDSFDTRYGYMMPMEKW--SLMKEQQRVFSSPL---FSLQDDLCVFHTVPIV 487

  Fly   774 VP--AQSAYLHLVNRHIKSMFRMGFIERWHQMN---LPSAGKCNGKSAQRQVTNHKVNMDDMQGC 833
            .|  ..|.:....:|.|..:...|.:.||..|:   :..||:...:..........:.:.|:...
  Fly   488 FPMVKNSIFKEPFDRLILDVTATGLLSRWRDMSFTEMIKAGQLGLEDRGHPKEFRAMKVGDLIQI 552

  Fly   834 --FLVLLLGF-TLALL--IVCGEFWYRRFRASRK 862
              |:..:||. |:..|  ::|  ||..:...:.|
  Fly   553 WRFVGWMLGLATIVFLLELIC--FWRHKMWQNMK 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 51/287 (18%)
Lig_chan 576..836 CDD:306551 52/285 (18%)
Ir94dNP_001138099.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.