DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Ir76b

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_649176.1 Gene:Ir76b / 40198 FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster


Alignment Length:453 Identity:115/453 - (25%)
Similarity:187/453 - (41%) Gaps:64/453 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   429 HFRNITMDILTVHNPPWQILTKNSNGVIVEHKGIVMEIVKELSRALNFSYYLHEASAWKEEDSLS 493
            |.|     |.|:.:.|........||..|.| |:..:|:..|.:..||:|.:..           
  Fly    84 HLR-----IATLEDFPLSYTEVLENGTRVGH-GVSFQIIDFLKKKFNFTYEVVV----------- 131

  Fly   494 TSAGGNESDELVGSMTFRIPYRVVEMVQGNQFFIAAVAATVEDPDQKPFNY--TQPISVQKYSFI 556
                  ..|.::||.: .....::|||..:...:|| |......||:.|.|  |..:...::..:
  Fly   132 ------PQDNIIGSPS-DFDRSLIEMVNSSTVDLAA-AFIPSLSDQRSFVYYSTTTLDEGEWIMV 188

  Fly   557 TRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLYAI----NRLAPLKEMRIVGLSTVKSCFW 617
            .::|.|.:......|||....|..::..:|...|.:||:    |||....:.....|.   .|.|
  Fly   189 MQRPRESASGSGLLAPFEFWVWILILVSLLAVGPIIYALIILRNRLTGDGQQTPYSLG---HCAW 250

  Fly   618 YIFGALLQQGGMYLPTADSGRLVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQ-LEDH 681
            :::|||::||....|.|||.||:...|||.:.:|.:.|..||.||||..||....:.:|. |..:
  Fly   251 FVYGALMKQGSTLSPIADSTRLLFATWWIFITILTSFYTANLTAFLTLSKFTLPYNTVNDILTKN 315

  Fly   682 KDIVQYGLRNGTFFERYVQSTTREDFKHYLER--AKIYGSAQEEDIEA------VKRGERINIDW 738
            |..|  .:|.|..  .|...||.|... .|.|  ...|....:|..:.      |::...:.:..
  Fly   316 KHFV--SMRGGGV--EYAIRTTNESLS-MLNRMIQNNYAVFSDETNDTYNLQNYVEKNGYVFVRD 375

  Fly   739 RINLQLIVQR--------HFEREK-ECHFALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRM 794
            |..:.:::.|        .|..|| .|.||:.:|.|:.::.....|..|....|.:..:..:...
  Fly   376 RPAINIMLYRDYLYRKTVSFSDEKVHCPFAMAKEPFLKKKRTFAYPIGSNLSQLFDPELLHLVES 440

  Fly   795 GFIERWHQMNLPSAGKC--NGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWYR 855
            |.::...:.|||||..|  :....:||:.|     .|:...:.::|.||..||.:...|..:|
  Fly   441 GIVKHLSKRNLPSAEICPQDLGGTERQLRN-----GDLMMTYYIMLAGFATALAVFSTELMFR 498

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 75/274 (27%)
Lig_chan 576..836 CDD:306551 74/283 (26%)
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 97/385 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447466
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.