DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Ir68b

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_648548.1 Gene:Ir68b / 39378 FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster


Alignment Length:447 Identity:96/447 - (21%)
Similarity:164/447 - (36%) Gaps:93/447 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   461 GIVMEIVKELSRALNFSYYLHEASAWKEEDSLSTS-AGGNES---DELVGSMTFRIPYRVVEMVQ 521
            |:...:|.|:..| :.:|...|     :.:|.... ..||.:   .::||..|...|        
  Fly   220 GVAARVVGEMLNA-SVTYVFPE-----DNESYGRCLPNGNYTGVVSDIVGGHTHFAP-------- 270

  Fly   522 GNQFFIAAVAATVEDPDQKPFNYTQ-------PISVQKYSFITRKPDEVSRIYLFTAPFTVETWF 579
            .::|.:..:...||    ..:.||:       |.|..:..::           :|...|....|:
  Fly   271 NSRFVLDCIWPAVE----VLYPYTRRNLHLVVPASAIQPEYL-----------IFVRVFRRTVWY 320

  Fly   580 CLMGIILLTAPTLYAINRLAPLKEMRIVGLSTVK-SCFWYIFGALLQQGGMYLPTADSGRL---- 639
            .|:..:|:.....:.:.||    :.||.....:: ...||   .:|:..|.......:|||    
  Fly   321 LLLVTLLVVVLVFWVMQRL----QRRIPRRGVIQFQATWY---EILEMFGKTHVGEPAGRLSSFS 378

  Fly   640 -----VVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHKDIVQYGLRNGTFFERYV 699
                 ::| |.:...||.|.|...|.:....|.::..||.::.|. |.|:..|.:.  |.::. |
  Fly   379 SMRTFLMG-WILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDLV-HLDVHIYAVT--TMYDA-V 438

  Fly   700 QSTTREDFKHYLE---RAKIYGSAQEEDIEAVKRGER----INIDWRINLQLIVQRHFEREKECH 757
            :|...|.....||   |....|.|.......|:|.:|    |..|:.....|.:....:.|:.. 
  Fly   439 RSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHARDFLAITYDSQAERPA- 502

  Fly   758 FALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFIERWHQMNL-------PSAGK----- 810
            :.:.||.........|:|..|.:||.:..........||.|.|.||:|       |.|.:     
  Fly   503 YHIAREYLRSMICTYILPRGSPFLHRLESLYSGFLEHGFFEHWRQMDLITRVGASPDAEEFLEDL 567

  Fly   811 -----CNGKSAQRQVTNHKV--NMDDMQGCFLVLLLGFTLALLIVCGE----FWYRR 856
                 .:..|.:..:.|.||  .:|.:||.|.:..:|..::.|....|    ||.|:
  Fly   568 GDQTDTDSGSNELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAVEHAHWFWRRQ 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 51/256 (20%)
Lig_chan 576..836 CDD:306551 68/295 (23%)
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 66/286 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462928
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.