DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Ir8a

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_727328.1 Gene:Ir8a / 31867 FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster


Alignment Length:575 Identity:113/575 - (19%)
Similarity:211/575 - (36%) Gaps:173/575 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   401 NFEFINIGYWTPVLGFVCQELAFPHIEHHFR----------NIT--------------------- 434
            ::.::::.:|:   .|:......|||:..|:          ||:                     
  Fly   309 DYNWLDMVHWS---NFLAYAPPLPHIQDQFQSPVPGLTFAVNISAGYYSSEHEAKTDLAAWSSVG 370

  Fly   435 -MDIL--------------TVHNPPWQILTK-NSNGVIVEHK-------GIVMEIVKELSRALNF 476
             |.:|              |..:.||..|.: ...|.::..:       |..::.:..||:.|||
  Fly   371 EMRLLNETISPARRFFRIGTAESIPWSYLRREEGTGELIRDRSGLPIWEGYCIDFIIRLSQKLNF 435

  Fly   477 SY-----------YLHEASAWKEEDSLSTSAGGNESDELVGSMTFRIPYRVVEMVQG-NQFFIAA 529
            .:           .|:|...|               |.:||           ::|:| ..|.|||
  Fly   436 EFEIVAPEVGHMGELNELGEW---------------DGVVG-----------DLVRGETDFAIAA 474

  Fly   530 VAATVEDPDQKPFNYTQPISVQK-YSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPTLY 593
            :....|  .::..::..|...|. .|...|||...:.::.|.....:|.|..::..::.||..::
  Fly   475 LKMYSE--REEVIDFLPPYYEQTGISIAIRKPVRRTSLFKFMTVLRLEVWLSIVAALVGTAIMIW 537

  Fly   594 AINRLAP-------------LKEMRIVGLSTVKSCFWYIFGALLQQGGMYLPTADSGRLVVGFWW 645
            .:::.:|             .:|.      |::..||:...:...|||...|.|.|||::|..:|
  Fly   538 FMDKYSPYSSRNNRQAYPYACREF------TLRESFWFALTSFTPQGGGEAPKAISGRMLVAAYW 596

  Fly   646 IVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQL--------------EDHKDIVQYGLRNGTFFE 696
            :.|::::.|:..||.||||..:.|..|..|.||              :.|:..|.......|.:.
  Fly   597 LFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTVVKDSDTHQYFVNMKFAEDTLYR 661

  Fly   697 RY--VQSTTREDFKHYLERAKIYGSAQEED----IEAVKRGERI--------NIDWRINLQLI-- 745
            .:  :.....:|||.:    :|:....:|.    :.|:...:.:        |:|...|....  
  Fly   662 MWKELALNASKDFKKF----RIWDYPIKEQYGHILLAINSSQPVADAKEGFANVDAHENADYAFI 722

  Fly   746 ---VQRHFEREKECHFALGRESFVDEQIAMIVPAQSAYLHL---VNRHIKSMFRMGFIER----- 799
               .:..:|..:.|:.....|.|.::..|:.|...|   ||   ::..|..:.:..|.|.     
  Fly   723 HDSAEIKYEITRNCNLTEVGEVFAEQPYAVAVQQGS---HLGDELSYAILELQKDRFFEELKAKY 784

  Fly   800 WHQMNLPSAGKCNGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWY 854
            |:|.|||:   |.....|..:|     ::.:.|.|:..|.|..||::.:..|..|
  Fly   785 WNQSNLPN---CPLSEDQEGIT-----LESLGGVFIATLFGLVLAMMTLGMEVLY 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 71/361 (20%)
Lig_chan 576..836 CDD:306551 66/313 (21%)
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435 87/443 (20%)
Lig_chan 520..818 CDD:278489 67/318 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR18966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.