DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Ir7b

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_572410.2 Gene:Ir7b / 31690 FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster


Alignment Length:514 Identity:99/514 - (19%)
Similarity:170/514 - (33%) Gaps:173/514 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   423 FPHIEHHFRNITMDILTVHNPPWQILTKNSNGVIVEHKGIVMEIVKELSRALNFSYYLHEASAW- 486
            ||....:|....:...|..:.|:.:...:.:|..|..:|.:::.:.|   .|||:..|:    | 
  Fly   200 FPSKLGNFYGCLLTCATWEDMPYLVWRPDGSGSFVGIEGALLQFMAE---NLNFTVGLY----WM 257

  Fly   487 -KEEDSLSTSAGGNESDELVGSMTFRIPYRVVEMVQGNQFFIAAVAATVEDPDQKPFNYTQPISV 550
             |||...:....|...||:                                     |.:....|:
  Fly   258 NKEEVLATFDESGRIFDEI-------------------------------------FGHHADFSL 285

  Fly   551 QKYSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLT-APTLY-AINRLA----PLKEMRIVGL 609
            ..:.|   ||...|.|     |::..|::.:..|:|:| ..:.| |..:|:    ||. .|.:||
  Fly   286 GGFHF---KPSAGSEI-----PYSQSTYYFMSHIMLVTNLQSAYSAYEKLSFPFTPLL-WRAIGL 341

  Fly   610 STVKSCF-------W----------YIFGALLQQGG----MYLPTADSGRLVVGFWWIVVIVLVT 653
            ..:.:|.       |          |....:|..||    .::|.....|||:..|....:||.:
  Fly   342 VLILACLLLMLLVRWRHHHELPRNPYYELLVLTMGGNLEDRWVPQRFPSRLVLLTWLFATLVLRS 406

  Fly   654 TYCGNLVAFLTFPKFQPGVDYLNQLEDHKDIVQYGLRNGTFFERYVQSTT--------------- 703
            .|             |.|:..|.:.:..::..|      |..|...|..|               
  Fly   407 GY-------------QSGMYQLLRQDTQRNPPQ------TISEVLAQHFTIQLAEVNEARILASL 452

  Fly   704 ---REDFKHYLERAKIY---GSAQEEDIEAVKRGERINIDWRINLQLIVQRHFEREKECH----- 757
               |.:...|||.:::.   ..||:....|     |:.|       |....:|...::.|     
  Fly   453 PELRPEQLVYLEGSELQSFPALAQQSGSSA-----RVAI-------LTPYEYFGYFRKVHPMSRR 505

  Fly   758 FALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFIERWHQMNL----------------- 805
            ..|.||....:|:|..|...|..:.::|:.|:.....||:|.|.:..:                 
  Fly   506 LHLVRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEHWTRQYVSAVDEKDESVARIASTS 570

  Fly   806 ----------PSAGKCNGKSAQRQVTNHKVNMDDMQGCFLVLL---LG----FTLALLI 847
                      ||..:.........|..:.::|.::...|.::|   ||    |.|.||:
  Fly   571 YSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLGAVVVFVLELLL 629

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 57/296 (19%)
Lig_chan 576..836 CDD:306551 64/339 (19%)
Ir7bNP_572410.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462919
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.