DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Grin2d

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_038951440.1 Gene:Grin2d / 24412 RGDID:2740 Length:1334 Species:Rattus norvegicus


Alignment Length:442 Identity:92/442 - (20%)
Similarity:180/442 - (40%) Gaps:86/442 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 KGIVMEIVKELSRALNFSYYLHEASAWKEEDSLSTSAGG-------NESDELVGSMT-------- 509
            ||..::|:|.|:..:.|||.|:..:..|....:.....|       ..:|..:||:|        
  Rat   482 KGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEI 546

  Fly   510 --FRIPYRVVEMVQGNQFFIAAVAATVEDPDQKPFNY-TQPISVQKYSFITRKPDEVSRIYLFTA 571
              |.:|:  ||  .|....:|....||.......|.: |.|:|.:                    
  Rat   547 VDFSVPF--VE--TGISVMVARSNGTVSPSAFLAFAWLTPPMSPE-------------------- 587

  Fly   572 PFTVETWFCLMGIILLT--APTLYAINRLAPLKEMRIVGLS--------TVKSCFWYIFGALLQQ 626
            |::...| .:|.::.||  |.|::....|:|:...|.:...        |:....|.:: ||:..
  Rat   588 PYSPAVW-VMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLW-ALVFN 650

  Fly   627 GGMYL--PTADSGRLVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHK------- 682
            ..:.:  |...:.:::|..|....::.:.:|..||.||:...::   ||.::.|.|.|       
  Rat   651 NSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEY---VDTVSGLSDRKFQRPQEQ 712

  Fly   683 -DIVQYG-LRNGTFFERYVQSTTREDFKHYLERAKIYGSAQ-EEDIEAVKRGERINIDWRINLQL 744
             ..:::| :.||: .|:.::| ...|...|:.|   |...: ||.:..:|.|:   :|..|....
  Rat   713 YPPLKFGTVPNGS-TEKNIRS-NYPDMHSYMVR---YNQPRVEEALTQLKAGK---LDAFIYDAA 769

  Fly   745 IVQRHFEREKECHF-ALGR-ESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFIERWHQMNLPS 807
            ::.....:::.|.. .:|. :.|......:.:...|.:...::..:........||...::.|  
  Rat   770 VLNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWL-- 832

  Fly   808 AGKCNGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGE---FWYRR 856
            :|.|:....  :|.:.|:::|:|.|.|.:||:...|:||:...|   :|..|
  Rat   833 SGICHNDKI--EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLR 882

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 57/275 (21%)
Lig_chan 576..836 CDD:306551 56/283 (20%)
Grin2dXP_038951440.1 PBP1_iGluR_NMDA_NR2 46..410 CDD:380601
PBP2_iGluR_NMDA_Nr2 427..838 CDD:270436 78/394 (20%)
PHA03307 <1125..>1312 CDD:223039
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166349915
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.