DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and Grin2d

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:XP_036008580.1 Gene:Grin2d / 14814 MGIID:95823 Length:1345 Species:Mus musculus


Alignment Length:441 Identity:91/441 - (20%)
Similarity:178/441 - (40%) Gaps:84/441 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   460 KGIVMEIVKELSRALNFSYYLHEASAWKEEDSLSTSAGG-------NESDELVGSMT-------- 509
            ||..::|:|.|:..:.|||.|:..:..|....:.....|       ..:|..:||:|        
Mouse   493 KGFCIDILKRLAHTIGFSYDLYLVTNGKHGKKIDGVWNGMIGEVFYQRADMAIGSLTINEERSEI 557

  Fly   510 --FRIPYRVVEMVQGNQFFIAAVAATVEDPDQKPFNYTQPISVQKYSFITRKPDEVSRIYLFTAP 572
              |.:|:  ||  .|....:|....||.......|.:..|         ...|:          |
Mouse   558 VDFSVPF--VE--TGISVMVARSNGTVSPSAFLAFAWLMP---------PMSPE----------P 599

  Fly   573 FTVETWFCLMGIILLT--APTLYAINRLAPLKEMRIVGLS--------TVKSCFWYIFGALLQQG 627
            ::...| .:|.::.||  |.|::....|:|:...|.:...        |:....|.:: ||:...
Mouse   600 YSPAVW-VMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLLW-ALVFNN 662

  Fly   628 GMYL--PTADSGRLVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHK-------- 682
            .:.:  |...:.:::|..|....::.:.:|..||.||:...::   ||.::.|.|.|        
Mouse   663 SVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEY---VDTVSGLSDRKFQRPQEQY 724

  Fly   683 DIVQYG-LRNGTFFERYVQSTTREDFKHYLERAKIYGSAQ-EEDIEAVKRGERINIDWRINLQLI 745
            ..:::| :.||: .|:.::| ...|...|:.|   |...: ||.:..:|.|:   :|..|....:
Mouse   725 PPLKFGTVPNGS-TEKNIRS-NYPDMHSYMVR---YNQPRVEEALTQLKAGK---LDAFIYDAAV 781

  Fly   746 VQRHFEREKECHF-ALGR-ESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFIERWHQMNLPSA 808
            :.....:::.|.. .:|. :.|......:.:...|.:...::..:........||...::.|  :
Mouse   782 LNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEIEMLERLWL--S 844

  Fly   809 GKCNGKSAQRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGE---FWYRR 856
            |.|:....  :|.:.|:::|:|.|.|.:||:...|:||:...|   :|..|
Mouse   845 GICHNDKI--EVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLR 893

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 56/274 (20%)
Lig_chan 576..836 CDD:306551 56/283 (20%)
Grin2dXP_036008580.1 Periplasmic_Binding_Protein_type1 <156..415 CDD:415822
PBP2_iGluR_NMDA_Nr2 432..849 CDD:270436 77/393 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167846426
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.