DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ir93a and GRIN3B

DIOPT Version :9

Sequence 1:NP_650924.3 Gene:Ir93a / 42471 FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster
Sequence 2:NP_619635.1 Gene:GRIN3B / 116444 HGNCID:16768 Length:1043 Species:Homo sapiens


Alignment Length:373 Identity:76/373 - (20%)
Similarity:138/373 - (36%) Gaps:69/373 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 IAAVAATVEDPDQKPFNYTQPISVQKYSFITRKPDEVSRIYLFTAPFTVETWFCLMGIILLTAPT 591
            :|..:.::.....:..::|.|........:.|..|..|.|..|..|....||..:...:.|||..
Human   527 MAVTSFSINSARSQVVDFTSPFFSTSLGIMVRARDTASPIGAFMWPLHWSTWLGVFAALHLTALF 591

  Fly   592 LYAINRLAPLKEMRIVGL-------STVKS-------CFWYIFGALLQQGGMYLPTADSGRLVVG 642
            |......:|      .||       |||.|       |:..:|...:..   ..|...:|||::.
Human   592 LTVYEWRSP------YGLTPRGRNRSTVFSYSSALNLCYAILFRRTVSS---KTPKCPTGRLLMN 647

  Fly   643 FWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHK-DIVQYGLRNGTFFERYVQSTTRED 706
            .|.|..::::::|..||.|.:...|   ..:.|:.:.|.| .....|.|.||.:|...::..::.
Human   648 LWAIFCLLVLSSYTANLAAVMVGDK---TFEELSGIHDPKLHHPAQGFRFGTVWESSAEAYIKKS 709

  Fly   707 FKHYLERAKIYGSAQEEDIEAVKRG--------ERIN--------IDWRINLQLIVQRHFEREKE 755
            |      ..::...:........||        .::|        :|:.:::          :.:
Human   710 F------PDMHAHMRRHSAPTTPRGVAMLTSDPPKLNAFIMDKSLLDYEVSI----------DAD 758

  Fly   756 CHFALGRESFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFI----ERWHQMNLPSAGKCNGKSA 816
            |......:.|..|...:.:|..|.....::..|......|||    ::|::| :|    | ||..
Human   759 CKLLTVGKPFAIEGYGIGLPQNSPLTSNLSEFISRYKSSGFIDLLHDKWYKM-VP----C-GKRV 817

  Fly   817 QRQVTNHKVNMDDMQGCFLVLLLGFTLALLIVCGEFWYRRFRASRKRR 864
            .......::::....|.|::|.||...|||...||..:.|....|.|:
Human   818 FAVTETLQMSIYHFAGLFVLLCLGLGSALLSSLGEHAFFRLALPRIRK 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 42/184 (23%)
Lig_chan 576..836 CDD:306551 56/294 (19%)
GRIN3BNP_619635.1 PBP1_iGluR_NMDA_NR3 19..405 CDD:107372
PBP2_iGluR_NMDA_Nr3 415..808 CDD:270438 57/308 (19%)
Lig_chan 576..842 CDD:278489 58/299 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165156002
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.