powered by:
Protein Alignment CG15696 and ATHB13
DIOPT Version :9
Sequence 1: | NP_650921.1 |
Gene: | CG15696 / 42469 |
FlyBaseID: | FBgn0038833 |
Length: | 179 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_177136.1 |
Gene: | ATHB13 / 843314 |
AraportID: | AT1G69780 |
Length: | 294 |
Species: | Arabidopsis thaliana |
Alignment Length: | 54 |
Identity: | 22/54 - (40%) |
Similarity: | 34/54 - (62%) |
Gaps: | 0/54 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 104 QQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKD 157
:|::.||..::..|.|..|...:||.:|.|...::.|||||||||.:.::.|||
plant 92 EQVKTLEKNFELGNKLEPERKMQLARALGLQPRQIAIWFQNRRARWKTKQLEKD 145
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
0 | 0.000 |
|
Return to query results.
Submit another query.