DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and HB16

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_195716.1 Gene:HB16 / 830169 AraportID:AT4G40060 Length:294 Species:Arabidopsis thaliana


Alignment Length:53 Identity:24/53 - (45%)
Similarity:33/53 - (62%) Gaps:0/53 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 QLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKD 157
            |::|||..::..|.|..|...|||..|.|...:|.:||||||||.:.::.|||
plant    67 QVKALEKNFELENKLEPERKTKLAQELGLQPRQVAVWFQNRRARWKTKQLEKD 119

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 15/38 (39%)
HB16NP_195716.1 Homeodomain 59..112 CDD:459649 21/44 (48%)
HALZ 114..155 CDD:460477 3/6 (50%)

Return to query results.
Submit another query.