DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and hmx4

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001038836.2 Gene:hmx4 / 751654 ZFINID:ZDB-GENE-060825-142 Length:238 Species:Danio rerio


Alignment Length:67 Identity:28/67 - (41%)
Similarity:43/67 - (64%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREKDESCDS 162
            |..|:.:|:..||:.:....|||:.:...||:||:||.|:|||||||||.:.:|:...:.|..:|
Zfish   116 RTIFSKRQIFQLESTFDMKRYLSSAERACLANSLQLTETQVKIWFQNRRNKLKRQLSTELEGPNS 180

  Fly   163 TF 164
            .|
Zfish   181 EF 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 20/45 (44%)
hmx4NP_001038836.2 Homeodomain 115..169 CDD:459649 24/52 (46%)

Return to query results.
Submit another query.