DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and gsx1

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001039254.1 Gene:gsx1 / 734120 XenbaseID:XB-GENE-855502 Length:243 Species:Xenopus tropicalis


Alignment Length:218 Identity:52/218 - (23%)
Similarity:81/218 - (37%) Gaps:73/218 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 QRLRASLPFHPYA----HP------ASYVSKESG-------------------GSPPASAAEAQI 63
            :::.:|.|..|||    ||      .|..|::||                   |.|...|:.:..
 Frog    18 KKVESSPPLFPYAVHPTHPLHGLPAGSCHSRKSGLLCVCPMCVTASHLHPPPPGIPLLKASFSSF 82

  Fly    64 PVYDWLQYTRYHPPKLPR--------------ALRQ-----------------NAPAKRTPGRLP 97
            .       |:|.|..|.|              ||.|                 ::|::.:..:..
 Frog    83 G-------TQYCPAGLGRQHSASTGINVSHGPALYQAAYPLPDPRQFHCISVDSSPSQLSSSKRM 140

  Fly    98 RIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERRE-----KREKD 157
            |..||..||..||..:..:.|||.....::|..|.|:..:|||||||||.:.::|     .|...
 Frog   141 RTAFTSTQLLELEREFASNMYLSRLRRIEIATYLNLSEKQVKIWFQNRRVKHKKEGKSSTHRASP 205

  Fly   158 ESCD-STFSSNASSPEPEMIVVT 179
            ..|. |:.||.....:.|.:.::
 Frog   206 HGCKCSSLSSKCLEEDDEDLAMS 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 18/46 (39%)
gsx1NP_001039254.1 homeobox 137..196 22/58 (38%)
Homeobox 141..194 CDD:365835 22/52 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.