DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Nanog

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_082292.1 Gene:Nanog / 71950 MGIID:1919200 Length:305 Species:Mus musculus


Alignment Length:180 Identity:34/180 - (18%)
Similarity:64/180 - (35%) Gaps:60/180 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKL-----------------PRALRQ 85
            |::.|:|..:..||.:....|.              :||...                 ||...:
Mouse     8 PHSLPSSEEASNSGNASSMPAV--------------FHPENYSCLQGSATEMLCTEAASPRPSSE 58

  Fly    86 NAPAKRTPG-----------------------------RLPRIPFTPQQLQALENAYKESNYLSA 121
            :.|.:.:|.                             :..|..|:..||.||::.:::..|||.
Mouse    59 DLPLQGSPDSSTSPKQKLSSPEADKGPEEEENKVLARKQKMRTVFSQAQLCALKDRFQKQKYLSL 123

  Fly   122 EDANKLADSLELTNTRVKIWFQNRRARERREKREKDESCDSTFSSNASSP 171
            :...:|:..|.|:..:||.||||:|.:.:|.::.:.....:......|:|
Mouse   124 QQMQELSSILNLSYKQVKTWFQNQRMKCKRWQKNQWLKTSNGLIQKGSAP 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 16/48 (33%)
NanogNP_082292.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..30 6/35 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..95 4/48 (8%)
Sufficient for interaction with SALL4. /evidence=ECO:0000269|PubMed:16840789 96..155 20/58 (34%)
Homeodomain 98..153 CDD:459649 19/54 (35%)
Required for DNA-binding. /evidence=ECO:0000250|UniProtKB:Q9H9S0 123..152 10/28 (36%)
PTZ00395 <190..>250 CDD:185594
10 X repeats starting with a Trp in each unit 198..247
Sufficient for transactivation activity 198..247
Sufficient for strong transactivation activity 248..305
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.