DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Barhl2

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_075245.1 Gene:Barhl2 / 65050 RGDID:620726 Length:384 Species:Rattus norvegicus


Alignment Length:69 Identity:27/69 - (39%)
Similarity:42/69 - (60%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 RQNAPAKRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRAR 148
            |::.|.:....|..|..|:..||..||.:::...|||.:|...||.:|.||:|:||.|:||||.:
  Rat   219 RESPPVRAKKPRKARTAFSDHQLNQLERSFERQKYLSVQDRMDLAAALNLTDTQVKTWYQNRRTK 283

  Fly   149 ERRE 152
            .:|:
  Rat   284 WKRQ 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 20/48 (42%)
Barhl2NP_075245.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..134
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 154..237 4/17 (24%)
Homeodomain 230..286 CDD:459649 24/55 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 364..384
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.