DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and hoxa5a

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_073787191.1 Gene:hoxa5a / 58055 ZFINID:ZDB-GENE-000823-9 Length:265 Species:Danio rerio


Alignment Length:121 Identity:34/121 - (28%)
Similarity:54/121 - (44%) Gaps:20/121 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 VSKESGG----SPPASAAEA-----QIP-VYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIP 100
            |||.|..    .||.|...|     :.| :|.|::........|.      .|    .|:.||..
Zfish   142 VSKVSSSMEEEKPPGSGQTASQNVSEAPQIYPWMRKLHISHDNLA------GP----EGKRPRTA 196

  Fly   101 FTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREK 156
            :|..|...||..:..:.||:.....::|.:|.|:..::||||||||.:.:::.:.|
Zfish   197 YTRYQTLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDNKLK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 15/48 (31%)
hoxa5aXP_073787191.1 None

Return to query results.
Submit another query.