DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and hoxc1a

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_571606.1 Gene:hoxc1a / 58046 ZFINID:ZDB-GENE-000822-2 Length:302 Species:Danio rerio


Alignment Length:86 Identity:32/86 - (37%)
Similarity:47/86 - (54%) Gaps:13/86 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 RIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREK------ 156
            |..||.:||..||..:..:.||:.....::|:.|:|:.|:|||||||||.::::..||.      
Zfish   219 RTNFTTKQLTELEKEFHFNKYLTRARRIEIANPLQLSETQVKIWFQNRRMKQKKMLREGLAQGLM 283

  Fly   157 -----DESCDSTFSSNASSPE 172
                 ||  ||..|...|||:
Zfish   284 LISGCDE--DSKKSDTCSSPD 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 18/45 (40%)
hoxc1aNP_571606.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 198..224 2/4 (50%)
Homeodomain 218..272 CDD:459649 22/52 (42%)

Return to query results.
Submit another query.