DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and hoxc11b

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_009298848.2 Gene:hoxc11b / 570925 ZFINID:ZDB-GENE-000822-3 Length:306 Species:Danio rerio


Alignment Length:62 Identity:24/62 - (38%)
Similarity:40/62 - (64%) Gaps:0/62 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 RLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKREK 156
            |..|.|:|..|::.||..:..:.|::.|...:|:..|.||:.:|||||||||.:|::..|::
Zfish   235 RKKRCPYTKFQIRELEREFFFNVYINKEKRLQLSRILNLTDRQVKIWFQNRRMKEKKLSRDR 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 18/48 (38%)
hoxc11bXP_009298848.2 None

Return to query results.
Submit another query.