DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and hoxb3

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001015971.1 Gene:hoxb3 / 548725 XenbaseID:XB-GENE-482576 Length:386 Species:Xenopus tropicalis


Alignment Length:162 Identity:45/162 - (27%)
Similarity:76/162 - (46%) Gaps:21/162 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 SLPFHPYAHPAS---------YVSKESGGSPPASAAEAQIPVYDWLQYTRYH-----PPKLPRAL 83
            |.|..|.|:|:|         .:||.|.....||.:.|...::.|::.:|.:     .|..|.| 
 Frog    78 SQPLSPTANPSSNTNSSSSQASLSKPSPAKSQASGSPASKQIFPWMKESRQNSKQKSSPPAPAA- 141

  Fly    84 RQNAPAKRTP-----GRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQ 143
             ::....|:|     .:..|..:|..||..||..:..:.||......::|:.|.|:..::|||||
 Frog   142 -ESCGGDRSPPGSSASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQ 205

  Fly   144 NRRARERREKREKDESCDSTFSSNASSPEPEM 175
            |||.:.:::::.|..|..|..:|..|:|...|
 Frog   206 NRRMKYKKDQKVKGMSSSSGGASPTSTPPLSM 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 15/48 (31%)
hoxb3NP_001015971.1 Homeodomain 157..213 CDD:459649 19/55 (35%)
DUF4074 325..384 CDD:463833
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.