DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and DUXA

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001012747.1 Gene:DUXA / 503835 HGNCID:32179 Length:204 Species:Homo sapiens


Alignment Length:84 Identity:30/84 - (35%)
Similarity:44/84 - (52%) Gaps:0/84 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 RTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERREKRE 155
            :|..|..|..||.:||:.|.|.:.:..|.......|||..:....:|::|||||||||...:||.
Human    12 KTNHRRCRTKFTEEQLKILINTFNQKPYPGYATKQKLALEINTEESRIQIWFQNRRARHGFQKRP 76

  Fly   156 KDESCDSTFSSNASSPEPE 174
            :.|:.:|:.|.....|..|
Human    77 EAETLESSQSQGQDQPGVE 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 16/48 (33%)
DUXANP_001012747.1 homeodomain 16..74 CDD:238039 22/57 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 73..101 7/23 (30%)
Homeodomain 102..155 CDD:459649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 163..204
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.