DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Lbx2

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_001102714.1 Gene:Lbx2 / 500224 RGDID:1561172 Length:196 Species:Rattus norvegicus


Alignment Length:118 Identity:37/118 - (31%)
Similarity:51/118 - (43%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 HPPKLPRALRQNAPAKRTPG--------RLPRIPFTPQQLQALENAYKESNYLSAEDANKLADSL 131
            |.|:.|:.....|..:..||        |..|..|||||:..||..:....||:..:.:.||..|
  Rat    56 HSPRAPQPSEGRAVPEAPPGPGTGVRRRRKSRTAFTPQQVLELERRFVFQKYLAPSERDGLAARL 120

  Fly   132 ELTNTRVKIWFQNRRARERREKREKDES------------CDSTFSSNASSPE 172
            .|.|.:|..|||||||:.:|:..|....            |......:||||:
  Rat   121 GLANAQVVTWFQNRRAKLKRDVEEMRADLASLCGLSPGVLCPPALPDSASSPD 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 19/48 (40%)
Lbx2NP_001102714.1 Homeodomain 84..140 CDD:459649 24/55 (44%)

Return to query results.
Submit another query.