DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and Dr

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_477324.1 Gene:Dr / 45285 FlyBaseID:FBgn0000492 Length:515 Species:Drosophila melanogaster


Alignment Length:114 Identity:43/114 - (37%)
Similarity:56/114 - (49%) Gaps:24/114 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 PYAHPASYVSKESGGSPPASAAEAQIPVYDWLQYTRYHPPKLPRALRQNAPAKRTPGRLPRIPFT 102
            |:..|..:.....||    .|.|               ||::...||     |..|.|.||.|||
  Fly   389 PFGPPGMFPGAGFGG----DANE---------------PPRIKCNLR-----KHKPNRKPRTPFT 429

  Fly   103 PQQLQALENAYKESNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            .|||.:||..::|..|||..:..:.:.||.||.|:||||||||||:.:|
  Fly   430 TQQLLSLEKKFREKQYLSIAERAEFSSSLRLTETQVKIWFQNRRAKAKR 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 24/46 (52%)
DrNP_477324.1 Homeobox 424..477 CDD:278475 29/52 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 47 1.000 Domainoid score I4539
eggNOG 1 0.900 - - E1_KOG0850
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.