DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and MSX1

DIOPT Version :10

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:88 Identity:40/88 - (45%)
Similarity:52/88 - (59%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WLQYTRYHPPKLPRALRQNAPA----KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLA 128
            |:|..|:.||.   |.|.:.||    |....|.||.|||..||.|||..:::..|||..:..:.:
Human   145 WMQSPRFSPPP---ARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFS 206

  Fly   129 DSLELTNTRVKIWFQNRRARERR 151
            .||.||.|:||||||||||:.:|
Human   207 SSLSLTETQVKIWFQNRRAKAKR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeodomain 95..144 CDD:459649 24/48 (50%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117
PTZ00449 <105..>248 CDD:185628 40/88 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 10/31 (32%)
Homeodomain 173..229 CDD:459649 29/55 (53%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.