DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and MSX1

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:NP_002439.2 Gene:MSX1 / 4487 HGNCID:7391 Length:303 Species:Homo sapiens


Alignment Length:88 Identity:40/88 - (45%)
Similarity:52/88 - (59%) Gaps:7/88 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 WLQYTRYHPPKLPRALRQNAPA----KRTPGRLPRIPFTPQQLQALENAYKESNYLSAEDANKLA 128
            |:|..|:.||.   |.|.:.||    |....|.||.|||..||.|||..:::..|||..:..:.:
Human   145 WMQSPRFSPPP---ARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFS 206

  Fly   129 DSLELTNTRVKIWFQNRRARERR 151
            .||.||.|:||||||||||:.:|
Human   207 SSLSLTETQVKIWFQNRRAKAKR 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 23/46 (50%)
MSX1NP_002439.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 18..55
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 69..117
PTZ00449 <105..>248 CDD:185628 40/88 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 133..174 10/31 (32%)
Homeobox 175..229 CDD:395001 28/53 (53%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0850
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
43.770

Return to query results.
Submit another query.