DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15696 and msx2

DIOPT Version :9

Sequence 1:NP_650921.1 Gene:CG15696 / 42469 FlyBaseID:FBgn0038833 Length:179 Species:Drosophila melanogaster
Sequence 2:XP_002936749.1 Gene:msx2 / 394987 XenbaseID:XB-GENE-852974 Length:256 Species:Xenopus tropicalis


Alignment Length:166 Identity:54/166 - (32%)
Similarity:78/166 - (46%) Gaps:33/166 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FSIEYILNRAGDRYVGTNAS--LGVLQRLRASLPFHPYAHPASYVSKESGGSPP-------ASAA 59
            ||:|.::   .|:.|...|.  .||......|.|.|      .::......|||       .|:.
 Frog    38 FSVEALM---ADKRVPKEAPHLRGVDASAAGSTPRH------LHMGIRDSPSPPGLTKTFETSSV 93

  Fly    60 EAQIPVYDWLQYTR----YHPPKLPRALRQNAPA-----KRTPGRLPRIPFTPQQLQALENAYKE 115
            ::: ...|...:::    |.||  ||.|   :|:     |....|.||.|||..||.|||..:::
 Frog    94 KSE-NSEDGTTWSKDGGSYSPP--PRHL---SPSTCTLRKHKTNRKPRTPFTTSQLLALERKFRQ 152

  Fly   116 SNYLSAEDANKLADSLELTNTRVKIWFQNRRARERR 151
            ..|||..:..:.:.||.||.|:||||||||||:.:|
 Frog   153 KQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKR 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15696NP_650921.1 Homeobox 97..144 CDD:278475 23/46 (50%)
msx2XP_002936749.1 Homeobox 134..188 CDD:365835 28/53 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000776
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.